DPCstruct | MC31172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9FZZ5 | 1-71 | MAAAAKTAVQPAVVVGGGRVGQALLSMGPPGADVLVGRGEKVPEDAPGPILVCTRNDDLDAVLDATPRSRW |
| A0A1R3GAU7 | 1-77 | MAAAAPTTTAAEVVPAVIVGGVRVGKALQDMGKGDDLLVKRGEAMPLDFEGPILVCTRNDDLEDVLESTPKSHWNAF |
| A0A835N4U3 | 38-114 | None |
| A0A3L6RLK5 | 1-70 | None |
| A0A6J5UFM9 | 37-111 | None |
| A0A383WC49 | 22-103 | None |
| A0A7S2T2A0 | 93-166 | None |
| A0A811R6R2 | 5-76 | None |
| A0A2G5D0Q5 | 23-93 | None |
| A0A822ZEV9 | 29-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.