DPCstruct | MC31171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3SIE2 | 10-105 | MEEQTNMQMDQIRKQIELLAVQAREIVNRKELSMLIYNAKLSFSPVIGQVYYLYEKQNQEHQVSMISPREWGKGTGPFKQFIAKVKL… |
| A0A4R9JP07 | 15-107 | TSRLAPAISLVDRAKEIRALKEEAELILQQAEKDIELHKAKCQFEKKPGQMIYLYAKESGDYFSLLSPNEWGNKPPHPFKAAYMMNP… |
| G5AQI0 | 23-161 | None |
| A0A1E2ULV2 | 7-103 | None |
| A0A1Y1NAC2 | 17-128 | None |
| A0A1Y6C1S1 | 90-199 | None |
| A0A1S3JB93 | 9-124 | None |
| A0A401U4W1 | 153-272 | None |
| A0A7Y2THC6 | 4-96 | None |
| A0A6J0USL4 | 26-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.