DPCstruct | MC31166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3ZQE8 | 2-86 | FLEPLNAAMQEFGIDTRLRMAAFLSQIGHESGQFHFMEELASGAAYDHRADLGNTNPEAIRIAAANGSTPGRFWKGQGPIQITGY |
| A0A819XDK0 | 1-80 | MPNCKHPEYLSHINAALVEGSITTCHRKAAFLAQLTHESGQLMYMEEIASGAAYEGRKDLGNTQPSDDKRSKGRGPIQLA |
| A0A7V3F8N3 | 98-166 | None |
| A0A813TDV5 | 29-104 | None |
| A0A1Q8YCF7 | 2-69 | None |
| A0A814F7X5 | 31-117 | None |
| A0A815C3L2 | 30-116 | None |
| H1W7K2 | 99-172 | None |
| A0A7Y7GI24 | 28-103 | None |
| A0A6C2YT43 | 325-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.