DPCstruct | MC31164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C2SK02 | 493-578 | FCDDELIHITNENTMFKQQARYLVCRHQLDLWAQVLHPNNTYRHQLIDQIVATALPESTNPDDVSTTIKAFLTADLPLELIELLEK |
| A0A6A4HRK2 | 2-71 | FKQQARYLVKHRQPELWAQVLVSDNLHRRALIDQIVATALPESTDPDDVSVTVKAFLIADLPIELIELLE |
| A0A815MS03 | 3-76 | None |
| A0A175K294 | 827-913 | None |
| A0A388M0W4 | 79-170 | None |
| A0A7R9LG82 | 252-338 | None |
| A0A7R9QLQ9 | 91-167 | None |
| A0A6J1NM86 | 132-217 | None |
| A0A819NSB9 | 732-807 | None |
| A0A1I8FH54 | 139-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.