DPCstruct | MC31160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 48 ± 4 aa |
| Standard deviation of domain lengths | 3.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 72.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R5GK53 | 203-249 | KTLLSICSLLSDANPDDPLVPSIAKEFVNDRAQHDKTAREWAARYAQ |
| A0A7J9BNF4 | 5-56 | TQVQNQVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAM |
| A0A5N6JWP9 | 223-268 | None |
| A0A077S0T7 | 228-274 | None |
| A0A7J0E7Y3 | 203-251 | None |
| A0A4S4CWT2 | 323-368 | None |
| A0A6A4PR22 | 32-84 | None |
| A0A668RME6 | 113-158 | None |
| A0A7J0FS22 | 350-398 | None |
| A0A834STZ7 | 56-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.