DPCstruct | MC3116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.77 |
| Pfam Score | 86.74 |
| Assigned Pfam label(s) | CL0369- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395VT45 | 557-672 | MGAHISASPNHQTSRSVPLKFRIDVAMSGRLGMEMQPESMTEEEKAFCKNAIAEYKMIRPVVQFGDIYRLLSPYDKLGAASLMYVSP… |
| A0A1V2QVP1 | 24-134 | PAHSSHRVTDLSFRAAVGLQGHAGLEWDLLGCDDAELKSVRAYGALYRELRDLLHSGTVIHPDDVDPALRVRGVVAHDRSQALWTVA… |
| A0A815WRK6 | 288-383 | None |
| A0A847PKQ1 | 102-214 | None |
| A0A2R7RUG5 | 41-159 | None |
| A0A1C3SM90 | 43-128 | None |
| A0A5J4YPU6 | 822-946 | None |
| A0A3S4KEY5 | 103-216 | None |
| A0A418KXB3 | 819-932 | None |
| A0A821G2T7 | 86-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.