DPCstruct | MC31158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 17.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A252A5H7 | 10-160 | SSSSGVHLVSSDVSIGNGAVWTDTELGDGGELFVEDGGLAVNTLVDKGDLTVDAGGVASGVTVTGNWNENGYFEVDGGTIADLTVKK… |
| A0A6N8Q6B0 | 23-187 | AGSLTVVTGSRAVDTIINANGKMDVYGKDVGTVLNSAGTQTIYASATSDKANIKGGKQTVYGLATEANIESGEQIVDGGSTEKTHIN… |
| A0A4V2BN80 | 11-140 | None |
| A0A149T4U0 | 133-264 | None |
| A0A3L4XCG5 | 51-187 | None |
| A0A8B4PBI3 | 55-219 | None |
| A0A376VEA4 | 3-129 | None |
| A0A252C144 | 7-162 | None |
| A0A0T9M807 | 413-541 | None |
| A0A1Y3G1C5 | 4-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.