DPCstruct | MC31157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 15 aa |
| Standard deviation of domain lengths | 15.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177PUM1 | 1-89 | MLEALESDELIIGAYTDRRGRTCPMLAAHRRGARIDVGDFPRAWDDFGRARRPRAATRRELEILRALLEESAEGDAPGSAEPKVATP… |
| A0A538K4K5 | 27-120 | LEGVRSNDIIVGAYVDRKGGVCPMLAAHRCGGRTDFLAFAHAWDRFTHAKRARLATEREIAVLVSYLEASLLDEDVRGADDLRGAIR… |
| A0A838FI36 | 31-133 | None |
| A0A7W1RTM0 | 1-67 | None |
| A0A7W0RC01 | 1-62 | None |
| A0A537Z526 | 32-116 | None |
| A0A537X7P0 | 1-102 | None |
| A0A838PK98 | 32-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.