DPCstruct | MC31154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 199 ± 31 aa |
| Standard deviation of domain lengths | 31.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S2V2D4 | 56-277 | VGLAVISQTCDVVREPGRVRYVSVCPMVVVDAKRMEEIERGQAPRFGFLSAAPDDVVVDFSRTMSVSKELLVSWERQRGCKDESQQL… |
| A0A3B9Y2R8 | 22-184 | YFLLDRNRGLVAESSVMVLLEKPVLLNLTPASGALDLATKQKFARWVAHRFDRSAFPDDIIGAVVKPILDNLSQMQVENDPDLDALR… |
| A0A7W8XJG1 | 16-212 | None |
| A0A377LTI1 | 2-211 | None |
| A0A7V9NDU7 | 35-218 | None |
| A0A6B1H9I7 | 81-241 | None |
| A0A1X0C035 | 10-196 | None |
| A0A543C3Z1 | 14-171 | None |
| A0A1G7PJU5 | 241-493 | None |
| A0A1A9BWS3 | 128-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.