DPCstruct | MC3115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 168 ± 37 aa |
| Standard deviation of domain lengths | 36.73 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2QUB9 | 9-185 | PGRVVPSSDQDVVTAVESLCLRAGWPGADRRELGQVLSPWFEAGWCVDAVLRAVDLTPSGTLQTEWRETDEPHEFLQKRLRAWFDDG… |
| A0A1V2PWW0 | 5-183 | LDPRQWPGRVIPETDAEIDTAVEALCLRATWPDANRAAVRRVVEPWFGEGWSVDALLAAVDRRPDGTRQGSPRNRDQVAHDFLRARL… |
| A0A1H9KLA5 | 117-281 | None |
| A0A368T8Q3 | 52-223 | None |
| A0A4V2XHH0 | 2-142 | None |
| A0A429EYU9 | 35-236 | None |
| A0A1D9FGE0 | 2-114 | None |
| A0A6J7LGG1 | 32-157 | None |
| A0A1R4J9W5 | 2-153 | None |
| A0A136PMV8 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.