DPCstruct | MC31146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 233 ± 50 aa |
| Standard deviation of domain lengths | 50.35 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 66.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 77.05 |
| Assigned Pfam label(s) | PF04724- CL0229- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JLQ4 | 1-142 | SSDGPKSRAVKSPDSDDEDIESVMVSYRSKRVAGREGPSDMGATAVLEIETEVDKDAQAIFENALKINKELKGKEDDKLYRGLNNYA… |
| A0A1B6CBU1 | 1-244 | MFKKIKRNRNESNRKRKSESSSEDESSVIKGEKRKRPNNPLIQKTGEFKLKHKVYDGEKNSSGEDEVISVSYKSKRLIVPEGPADQG… |
| A0A7J6GLQ4 | 293-587 | None |
| U6MZ77 | 1-256 | None |
| A0A6J1WHF0 | 11-174 | None |
| A0A7E4W3D2 | 4-322 | None |
| A0A1R3J162 | 402-700 | None |
| A0A2H9TN64 | 2-204 | None |
| A0A2G5BEP9 | 43-291 | None |
| A0A1E3NKA1 | 1-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.