DPCstruct | MC31145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6BYX9 | 1-148 | MYQSLLKQALDDQKVHITLLKQTMDQMMFISNCTSDREFRCSPESNSRLLPQISVTDSSADSRLIDWLKGLNLDQRSIDKFLMEEYC… |
| A0A151P717 | 98-212 | VETGRLLQELVQKEQEWQGLVRRALQAARQDANTGRRSLPVVVSAPCQAQPPDPLLVDWLQHHSVDRDTTETLLAHGFTLHDLLTCA… |
| A0A672V7Q6 | 26-160 | None |
| A0A2C9JMY3 | 1135-1263 | None |
| A0A340Y8Q0 | 2-126 | None |
| A0A0B1S5M6 | 106-256 | None |
| A0A670Y8Y6 | 187-306 | None |
| G7Q2C0 | 657-775 | None |
| A0A4U5VGN6 | 371-493 | None |
| A0A2K5UAH8 | 120-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.