DPCstruct | MC31141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 156 ± 21 aa |
| Standard deviation of domain lengths | 21.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151KY72 | 33-201 | VSEVAVVIIGSYDNPYARASRYLERVKMIYEGVDCSFPSTEYFHDDVYSFFIFCFHIKDWLKSDTRLNISSSDVEAYIKDHIELQLC… |
| A0A3G8MAD9 | 1-162 | MFDDLGALFMNSVIAAHDEYVIKRDERKSGRDQHLRAAIGLATALFHIREHLPAQLAKSRRDIEAACPDYRLIADVANATKHAQVKR… |
| A0A1F9U590 | 11-182 | None |
| A0A3N5FNU7 | 1-155 | None |
| A0A7Y3H9I9 | 2-135 | None |
| A0A495URN9 | 1-150 | None |
| A0A2U1RMB5 | 5-146 | None |
| A0A2P9ILU9 | 112-268 | None |
| A0A2H0FP95 | 1-121 | None |
| A0A6J4FK27 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.