DPCstruct | MC31134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 173 ± 25 aa |
| Standard deviation of domain lengths | 24.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670JI82 | 2-175 | NSEAAHLMRCLQQIHKVFSNANEILAGISQPSVCSEVLLSAPGTAYILGLSEVYRVSKRLEEGMKARRAESDALLHCLRKVDLAWNN… |
| A0A183GX15 | 3-141 | CWEKVITAAEAIFKTADKLLGQASDSVMKEIAQTERGDGYLRCLNHLFFVVRRVERSAKSELPKKCLDDIAYCTKVWERLCAFIDDL… |
| W6U546 | 190-364 | None |
| A0A0G2K0L4 | 186-358 | None |
| A0A4W3HQ51 | 3-188 | None |
| A0A0N4Z250 | 129-278 | None |
| A0A059B6M2 | 821-1035 | None |
| A0A7C9EN89 | 1-226 | None |
| A0A6P8S3R1 | 4-174 | None |
| A0A6A4W859 | 315-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.