DPCstruct | MC31133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R9XLL5 | 21-100 | QAAETDLNAAVAGIANPLGDLKVNPLAKTGVDPLDNGVATKVADFPAVGTTMVTGILTQGPSVKELPTAAVGSLLGPVLP |
| A0A0A8ELN9 | 47-121 | HAVARSVTGSTGRGLGPVKDLKLDPMNNTGVDPLDNGLGTQVADFKPVSTKQVTDPVTKGGSLRSLPVTGTAMGL |
| A0A2U3C425 | 34-119 | None |
| A0A7K3GAQ9 | 1-75 | None |
| A0A1Z1WHW6 | 17-98 | None |
| A0A7Y6C5W0 | 53-134 | None |
| A0A1J7CFY2 | 51-118 | None |
| A0A1V2RJ81 | 32-112 | None |
| A0A6I5DEP1 | 41-108 | None |
| A0A1V0TW40 | 112-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.