DPCstruct | MC31130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 249 ± 22 aa |
| Standard deviation of domain lengths | 21.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6ER27 | 1-254 | MTVLGQQLENPYSVGNMRKALANLSPKTRAGITDMDIQPTHYYVKFHPRSSEELDLILQDSTIIWYDIPLDYEIEEYGSYYHDPTIP… |
| A0A6G7J6H5 | 69-317 | VTLGEPIKIPQTVQNMQYAWEKLQERELYMGTENPVKVNKLYVRFLPKSKEQLLELSRYDSSLDLFDFPLHYNFEPTSDHNDGYRDR… |
| A0A2T7BMA1 | 25-254 | None |
| A0A1V5YN41 | 73-364 | None |
| A0A7W1V1H0 | 2-263 | None |
| A0A514CEK8 | 2-233 | None |
| A0A7Y4X144 | 49-293 | None |
| A0A0A2ETB6 | 1-231 | None |
| A0A2M7NES2 | 13-317 | None |
| A0A7X7NFH9 | 44-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.