DPCstruct | MC3113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 180 ± 14 aa |
| Standard deviation of domain lengths | 14.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2QII0 | 3-187 | REQEGTYLVFLPGLHGNPGGMVKVTSLGSTPNACSPVVWMPWRNPDTGKGFLVVRVACATLRGVPVDAAFTLSYSVDLGSTADVRIP… |
| A0A7T9IBF2 | 39-199 | SRAGTGRYTITFTGMNFARGNVQVTAYGNANVCNVVNWYGATINVACRNPAGAPADSRFSAIYRNASLPAYVWAHSGTTPTYDASST… |
| A0A6B1L9V7 | 1-179 | None |
| A0A1K0FJ71 | 71-245 | None |
| A0A7V7MUF8 | 190-353 | None |
| A0A6V8KWY0 | 77-274 | None |
| A0A7Y6AB64 | 1-164 | None |
| A0A166R443 | 302-499 | None |
| A0A3M1KFY8 | 174-377 | None |
| A0A6V8K9W0 | 861-1040 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.