DPCstruct | MC31129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834DCC7 | 1-124 | MWEFNFKFKKQPPRLKSKCVGVLQPPVQYEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTVNVSTDMRHHRVRLVFQDSPVH… |
| A0A815RFV4 | 1-149 | DAIQKEPHFLLSSRCVRIWYSKRTTPRELHNYYFEFCFDNDQQIKQENIQIEALSSMFQIDNQYMIDKNSYILHVICSNFVPMGPYM… |
| A0A6J2UHQ1 | 103-253 | None |
| A0A834M2P1 | 1-114 | None |
| A0A194REB4 | 188-318 | None |
| A0A4Z2G9R9 | 129-267 | None |
| A0A821S647 | 106-217 | None |
| A0A4C1W9N7 | 182-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.