DPCstruct | MC31128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.45 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | PF07670- PF07662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090PXF0 | 143-234 | TIVFFSAFTSLMYYLGILQKVVFVFAWVMSKTMRLSGAESLAAAANIFIGQTEAPLVVKPYLEKMTKSEILCLMVGGMATIAGGVLA… |
| B3RUU1 | 235-318 | IVVFFSATIAVLYYLGVMKWIITRIAWLMQITMKTSATESLNAAGNIFIGQTEAPLLIRPFIQYMTVSELHAVMTGGMATIAGS |
| M4TSP8 | 92-195 | None |
| A0A7E4REK3 | 175-258 | None |
| A0A3B8UTB6 | 2-91 | None |
| A0A452E2W7 | 258-357 | None |
| A0A6J3JG26 | 268-367 | None |
| A0A7I8VUQ6 | 620-719 | None |
| A0A1Z4RPU0 | 45-135 | None |
| A0A378NF15 | 6-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.