DPCstruct | MC31125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 257 ± 37 aa |
| Standard deviation of domain lengths | 36.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 62.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 43.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815NL24 | 1-275 | MARQSVSISLATGVHLRLLSHRNWLKRSTAFTTTAGQSVESGETVTVDTSAIFETNEYLDKTATNIYRSSSPQIVREVLTHGGNGAY… |
| A0A818V472 | 1-205 | MVPDPKIIRRSSPERGVTYAQRVVIQCLQPPPLPPPEPLIIKEVRPAQPPPPEPLVICERPSGGTTPPPLILRERPPIPPPRISGGT… |
| A0A814HWR2 | 118-405 | None |
| A0A815P0N8 | 1-270 | None |
| A0A817S6K1 | 120-328 | None |
| A0A818MQP7 | 5-298 | None |
| A0A816KWG5 | 6-314 | None |
| A0A820SCS1 | 1-238 | None |
| A0A820KBB2 | 1-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.