DPCstruct | MC31124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815N8V4 | 165-259 | SSSLAKTEIPRCIQKMMDGFNTTPRSSPYIRIDSYLYNGKITYYASSSCCDRFNPLFDGECKQICAPSGGFIGRGDGKCADFHESAT… |
| A0A7D5RSK2 | 1-82 | MDAPACIQTLIKTDPQPIEVWRYKFDGQMVYYVAADCCDQFNSVYDSNCNLICHPSGGIAGGGDGQCPEFHNTATDGVLIWK |
| A0A2K8VGF9 | 18-118 | None |
| A0A813Y3R8 | 81-194 | None |
| A0A554KCH8 | 148-258 | None |
| A0A5M6D4F6 | 11-118 | None |
| A0A2H9TDB2 | 30-126 | None |
| A0A0Q7B0Q5 | 38-118 | None |
| A0A818ZR91 | 70-162 | None |
| A0A1N6YG74 | 33-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.