DPCstruct | MC31123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815N0T9 | 1-127 | MKFFFDTQDDIRKLLCVMLGSRQGRQLFNKFIDQKLLKSWWTNGQWLFFLFDSKANGFLKKLFDIYPSLIHMLDKDGNNPLLYVCLT… |
| A0A813P7P2 | 357-460 | SKTLNILTGRSPGRQLLKLFFDEKPLEPWLISKDLFFLLLFKKERQFIERILKLKPELVHAMDEYGNNPLMYVCLKVRGCRQRIVRY… |
| A0A819PZ72 | 399-503 | None |
| A0A813UDV4 | 67-186 | None |
| A0A814VAM5 | 192-320 | None |
| A0A817KP60 | 68-191 | None |
| A0A820CXH8 | 1-103 | None |
| A0A814A3F9 | 75-198 | None |
| A0A818RPT3 | 171-296 | None |
| A0A820CC27 | 76-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.