DPCstruct | MC31122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 177 ± 25 aa |
| Standard deviation of domain lengths | 24.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813P5H9 | 1-123 | MANNKIQCFICNEEKITYPCKGCAEEFCLKDLAKHKEILNEELYHITNEYNEFKQTINEQKQNLRIHSLIKQIDKWEIKSIEKIQQK… |
| A0A815MIQ7 | 1-176 | MPKEKILCSVCHKEAGICNCTGCKAFFCMKDFANHRQWLSGEFEKVIEARNRLQEVVSDRKILADFRAALYTYIDQWKTDALDKIQY… |
| A0A815I5U2 | 1-171 | None |
| A0A815I8Q4 | 1-120 | None |
| A0A816R0N9 | 2-167 | None |
| A0A816R1S2 | 2-187 | None |
| A0A814PZH1 | 1-206 | None |
| A0A813MM00 | 1-140 | None |
| A0A814R7Q4 | 1-210 | None |
| A0A814TPA0 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.