DPCstruct | MC31119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 199 ± 27 aa |
| Standard deviation of domain lengths | 26.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3M659 | 9-174 | AHEKRLNLLLCNAINSAANLVNEIDISCVGYTDETGKLVAFIDPNIPLNLFPIPQNLSLFRISGTIPITIITNSNSQELSKEFVFTE… |
| A0A0H3M1F7 | 8-149 | EYTQNLHSRVLDDLNDMKEKIDVTRCRCIGKTDNSGNLTIFTSKNNKNDLCTPEGKSLFLIRCHLSRHTVNKYPAIKELLYNFIHSA… |
| A0A6I6ATK6 | 1-211 | None |
| X5H2F6 | 3-196 | None |
| X5GLL2 | 217-443 | None |
| X5GKJ8 | 8-249 | None |
| Q5FFQ9 | 14-220 | None |
| Q3YS35 | 1-213 | None |
| Q3YS32 | 207-404 | None |
| A0A6I6AU15 | 8-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.