DPCstruct | MC31118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496YFL0 | 1-140 | MNARRAVITARAAGKLLRPGRVWIESGPEGEEVARAAITYQGVAVGALEFDPVNGVILPCGYHPRIFNTAAPASEIVQELPGIIRNL… |
| A0A1J0LTQ8 | 20-126 | ERALARCVEVVRTLEVQALYREDGVVLVLLGRERPLLLVALEGGRPMPHAGPPRGRPLGKRPLPFLRELTLARFVAVGEKEYRCFIL… |
| A0A7C3THQ8 | 162-276 | None |
| A0A399EVY2 | 1-155 | None |
| H8GZE0 | 61-208 | None |
| A0A7C1EZ73 | 1-150 | None |
| A0A1H6XG62 | 81-213 | None |
| A0A1R1MJK9 | 45-185 | None |
| Q9V1E2 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.