DPCstruct | MC31117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 344 ± 48 aa |
| Standard deviation of domain lengths | 47.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4TPH0 | 12-416 | NLSRKTFLSMWSYQNPFYEEGKELCDVLVVFGDDVIIISDKVISYSEDKAPEVAWSRWYRKAVEASAGQLRGALKTIKTSPEAIHLD… |
| A0A496Y5E4 | 2-341 | LFSVKSYELNPLNAPMVSLQRWQRKAVEDSIRQLYGAERGLEQTTHVTRFDGTQGLPLPAILDRRIHRISVSLGGKGLIPIISRDFG… |
| A0A143BSH6 | 291-608 | None |
| A0A543N3C6 | 56-455 | None |
| A0A645BPP9 | 2-350 | None |
| A0A6B1BZQ9 | 362-668 | None |
| A0A7Y0PE55 | 5-314 | None |
| A0A4Y9MA79 | 10-375 | None |
| A0A2N4WQI2 | 110-481 | None |
| D7E6U9 | 226-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.