DPCstruct | MC31111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 175 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847B2N9 | 43-205 | LKNIEAAREVFLKQYKVQNIVKWIVSVAALALIIVGWLVFLDISVYLTIGTVGASLLLILLYNFFIKRYLNGKMKVYFDEFYKNTTE… |
| A0A3B8TP79 | 1-170 | MKTIEELKAYYETDLLPTLRVLDRARKKVLYKLFLGILLSVATPIIALYFFFGPVSLMVICFPVWIGVVIYLAILIGNYKKSFKVGI… |
| A0A661D353 | 83-243 | None |
| A0A6N6K980 | 307-472 | None |
| R6REV2 | 61-230 | None |
| A0A847PDA8 | 40-206 | None |
| A0A1T4PNY6 | 194-365 | None |
| A0A1H5V017 | 65-237 | None |
| A0A1Y3TW36 | 1-183 | None |
| A0A849TDM4 | 5-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.