DPCstruct | MC3111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109DFU9 | 1-108 | MKKIEQTLDKQVKYIPHGYHIMREKEASMINDLYIDNINNFATFYNEKLASKTIDYVFKDNHALSLLSVNFGKENFPHLLGLRFDRR… |
| A0A6L6L2Y5 | 5-100 | DKKAALKIMIEAVKQYEEKLNDKQFLIIYREGKDIKTVNVGFRDMNFLHMTGVKTRLSAQQFYVACLESKLSEYDFEIDNKGKVQQK… |
| A0A099YBG1 | 33-134 | None |
| A0A139PJQ3 | 133-253 | None |
| A0A5A5U6L3 | 2-115 | None |
| A0A3S4P3E2 | 495-606 | None |
| A0A415JN51 | 1-112 | None |
| A0A137PJP0 | 2-112 | None |
| A0A8B6L8E0 | 109-218 | None |
| A0A3R9IK72 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.