DPCstruct | MC31107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W4DN53 | 1-65 | MKKRIHLELRNRTPSDVRELVLDNCRSDEGKIQGLTADYVKLEFLSLINVGLTSIAKLPKLVQLK |
| A0A2K5DWA9 | 1-68 | MEMGRRIHLELWNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKK |
| A0A2Y9G1T4 | 1-74 | None |
| A0A665UQF0 | 1-68 | None |
| A0A3B5QEN2 | 2-72 | None |
| A0A812BII8 | 1-72 | None |
| A0A6A6LP51 | 1-82 | None |
| H9GDE8 | 1-74 | None |
| A0A3Q3XIN8 | 1-60 | None |
| A0A1I8BWU4 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.