DPCstruct | MC31106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 144 ± 22 aa |
| Standard deviation of domain lengths | 22.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5DU90 | 7-139 | IKKPRTGRLKKPFVKVEDISQLCRPFYLQLINMPFVNYSIQKPCSPFDVEKPLSRQKQTQIKLRIQMDGDKYEKKKGYCECCLQKYE… |
| A0A177ELH3 | 1-116 | MEYRVFKHPYILIEDESGRHRPFFKEYDGTTKENVVPTIVFSPNTPKGPGSKEKPIAKPGICEMCVVRYTDYNQHIAEKDHISTVKD… |
| A0A665UK32 | 175-330 | None |
| A0A7R9A3A6 | 224-408 | None |
| A0A6S7HXI5 | 57-161 | None |
| A0A090MW66 | 171-299 | None |
| A0A7R9CV18 | 270-445 | None |
| A0A0P4WG40 | 193-338 | None |
| A0A7E6CHV2 | 19-166 | None |
| A0A218UGW0 | 326-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.