DPCstruct | MC31104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 162 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18054 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7IAA4 | 162-307 | GTWVTPTASWSLVGCNENGEVTQSISNTIRYSKSISESTAIEIGAEIEAGYAFGSVTVSTTFSYSLAQEWTESQEQSEEITFTCQVY… |
| A0A078ABI8 | 53-218 | ADFLKAAGEVDKLRGEWVKRFSTSNGKISSQLTIGITQETSETKSKTFGASLEAAASSGVSFLGSGAEITVTASASASMASEITSSL… |
| G8PGR6 | 239-371 | None |
| A0A812NTU4 | 76-206 | None |
| A0A0P1EQT4 | 284-446 | None |
| A0A7D9DTE2 | 70-223 | None |
| A0A7S1BZC7 | 749-950 | None |
| A0A7S1R963 | 53-227 | None |
| J9J1X2 | 138-345 | None |
| A0A813JMJ6 | 181-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.