DPCstruct | MC3110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 187 ± 38 aa |
| Standard deviation of domain lengths | 37.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415NK48 | 5-174 | AKQYKDIYVDYEYLICSVAFEKSDYYIIATEEDNFQHLTGVQSKIDAKTFFRKCYDGTLAEVDFDFAKAGQNEKSAKGTVRRKIQVL… |
| A0A359MTY8 | 6-173 | YHYIIKDSERQYDIELRFDKENLSHLLGLESIAKYNLNTDELKMFKGIQGWNNIKNGSITMAFLKNINKKRFKSGKDKMVFFYLVPK… |
| A0A413CV28 | 15-230 | None |
| A0A109DFU9 | 32-231 | None |
| A0A8A5Z4L7 | 12-184 | None |
| A0A134AJV2 | 3-181 | None |
| A0A0R1PAP1 | 1-144 | None |
| A0A829U3K9 | 73-273 | None |
| E0Q6Z5 | 63-245 | None |
| A0A1I5WEC5 | 23-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.