DPCstruct | MC311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 17.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9RSK5 | 62-138 | IGQSEELKKCFERIDEEQRLNPPVNPQESDFEPCSIQCFAYDPVCGKDGVTYACGVEDAACHGVAVEHKGECTVSTS |
| I1JH79 | 4-123 | FSRFLAVVAIAVAALCVILPVAAAVDLEDPGVLQLPSESLCGKTMPLSCPAKCFRADPVCGADGVTYWCGCAEAACAGVEVAKFGFC… |
| A0A6V7PF91 | 8-116 | None |
| A0A835JIL9 | 110-193 | None |
| A0A165ZRY3 | 5-109 | None |
| A0A061DZR7 | 60-170 | None |
| A0A438E0S4 | 36-161 | None |
| A0A835JGB6 | 8-121 | None |
| A0A5N5K763 | 1-94 | None |
| A0A5C7IPI2 | 9-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.