DPCstruct | MC31099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 222 ± 33 aa |
| Standard deviation of domain lengths | 33.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077ZY86 | 1-235 | MNGYVDEQTNQCVSNCGPGRYGNITLDNQGMIELTQCLDCHPSCFECSSEQECKSCNKGYYLEIQQGKTSGVCKRKQGQFEGQFYVQ… |
| A0A078B746 | 159-356 | SGQAEYSYRAMIKTSICEVCNSTCEECQNQIYCSSCKKGYYLEKISLLVSYGYCKLKQSNFTEATLYVTNKDITENIQLRDGSISKP… |
| A0A078AIQ3 | 15-176 | None |
| A0A078AF64 | 165-375 | None |
| A0A078A8P9 | 25-293 | None |
| A0A078A7P6 | 96-301 | None |
| A0A078A2V2 | 223-457 | None |
| A0A078A0A8 | 52-262 | None |
| A0A077ZZ79 | 44-249 | None |
| A0A077ZTS3 | 163-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.