DPCstruct | MC31097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8B8I8 | 54-114 | FKKVTPHCEDQFFNNNGSVKIWYGKNKEKELEYVTALGLHPETGKTLKPITQYMINKHICN |
| A0A5N5IT55 | 1-83 | MDRVKLNSFKKVEVTMATDFFSEDEKPLIWYFKTKGGEMEFFTAPGLHPITGETLRKITPYIIETYVPLHINNTDSFLPRNQE |
| A0A4R5C8R8 | 1-69 | None |
| A0A497YU66 | 193-253 | None |
| A0A0X7BAB4 | 251-309 | None |
| I3YRT8 | 352-418 | None |
| A0A2S5AFP9 | 100-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.