DPCstruct | MC31080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 14.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662DEI5 | 73-199 | TLVAGDGSVTDSDLPLAPADDGGDAPASSGFIVDGGLDISEAIAYEGTEVVAVRGFFVSEGTAARLCEALAESFPPQCGGVSVVVTN… |
| A0A2N2LIE0 | 3-127 | VALAVTIALGWTPVDIAEGDPAPPVPPAAAAQGLPYFSVVEAQASGFGEPVRVHGFMVVNDGEMRLCQALAKSLPPRCAGDSLRVIG… |
| A0A7W1ZA53 | 66-175 | None |
| A0A7G6YZQ1 | 11-121 | None |
| A0A3B0S9A8 | 20-166 | None |
| A0A3B0TC60 | 5-149 | None |
| A0A4T0UYV8 | 17-160 | None |
| A0A520XPS3 | 4-133 | None |
| A0A838HNU9 | 1-137 | None |
| A0A7V9IHD7 | 211-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.