DPCstruct | MC3108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18789 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9JW08 | 16-75 | WNKYYSVMRPVSIGTHPKNGLMDFINYDTRTEVSGRMVWAELFYNRELTQKELEDFEMIR |
| A0A1C7G9R9 | 2-67 | KYKYYSTQRPVGPGTYPEPKENPARALHNFHEKEFVPEIGRSAWGYVEYDRPLKNEDVSGYELVPA |
| A0A162IQH9 | 39-101 | None |
| A0A6L5XA23 | 1-66 | None |
| A0A087Q9S9 | 580-643 | None |
| A0A2P8EL11 | 2-64 | None |
| A0A6I2RKK1 | 2-71 | None |
| N2A9F2 | 59-135 | None |
| A0A1Y4SAG7 | 1-64 | None |
| A0A7X7EXY2 | 39-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.