DPCstruct | MC31074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 227 ± 65 aa |
| Standard deviation of domain lengths | 64.62 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6AF21 | 224-484 | GTFHQEHVGKIVFSSSPIEAGQENAAAITSTFAAGDRIYGMMYFDGTYKEVTGGSSVAHTRLLVDGNEMVSYVFKLDAEGSARSWLK… |
| A0A6U4RSV3 | 33-249 | KVPPECWYGQPLVELSLLPMTAFHESHRGLVCFASRPIPTSRRELDRLPGAQPQVLPEAAVVDLSSSNLFAMGYLYNTALYTEHMWR… |
| A0A2J6HDT4 | 8-187 | None |
| A0A1G7BAZ4 | 39-409 | None |
| A0A1G3MPA0 | 1-131 | None |
| A0A2N5YU87 | 28-187 | None |
| A0A7Y4TSZ9 | 281-485 | None |
| A0A7C4P8C1 | 16-196 | None |
| A0A1Q3GFN7 | 196-389 | None |
| A0A1Q3H0P2 | 838-1087 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.