DPCstruct | MC31071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828AJY9 | 415-484 | GRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDL |
| A0A0B0I3E0 | 1-73 | MYLGGGFAGDRLNKLYKENIGEKEILDSLRPILAQYAENREPGEHFGDFVIRAGYVQEVRDGQEFHEQNSVTI |
| Q0VMM4 | 14-91 | None |
| M2Q870 | 805-871 | None |
| X0J7H0 | 909-973 | None |
| A0A850QWD3 | 1-64 | None |
| A0A533J0I8 | 304-372 | None |
| W1WVQ4 | 190-258 | None |
| A0A813A3M6 | 60-133 | None |
| A0A7H4NDG8 | 33-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.