DPCstruct | MC3107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 402 ± 82 aa |
| Standard deviation of domain lengths | 82.44 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7BV28 | 18-327 | LEDGIRNMAKQLPASATEISAVAEAAGQLGIQTPNVLSFSRTMIDMGESTNMSSETAATSLARFANITKMRQTDFDKLGSSIVDLGN… |
| A0A1C7FZ61 | 47-437 | LGLSWADKFKQAVEKFGGWAIATGSVMELWNLFRRMPKEVYNIDISMTSLYKVTDETERKYSEFLDKAYSKAQALGRSISGLVEQTA… |
| A0A0K2RS29 | 2-512 | None |
| A0A430D6K9 | 1-498 | None |
| A0A842MQP2 | 281-650 | None |
| A0A0F2N598 | 242-666 | None |
| A0A655SCF6 | 2-243 | None |
| A7AXU0 | 293-595 | None |
| A0A1Y0C3N4 | 3-326 | None |
| F5NSK0 | 151-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.