DPCstruct | MC31069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5L9G2 | 40-116 | SINSAAVRNPALIDELAKAFGVQFVIVAVDTRVLDGKNIVHLNGGRLPTEKQTLDWILEAESRGAGEILLTSMDHDG |
| A0A0B0HMV6 | 4-76 | PQLIADGARRFGSQCIVVAVDAKFNGAWGEWEVYTHGGRKASGIRALEWVKQAEKLGAGEILLTSMDADGTKD |
| A0A6N6XA28 | 45-119 | None |
| A0A6A5L1Q9 | 98-182 | None |
| A0A1G1YKI0 | 101-178 | None |
| A0A7E4SEQ0 | 280-354 | None |
| A0A7Y4WAS1 | 87-164 | None |
| A0A7W5VHS8 | 237-316 | None |
| C4LI94 | 102-189 | None |
| A0A1V5BFS2 | 270-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.