DPCstruct | MC31060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 304 ± 31 aa |
| Standard deviation of domain lengths | 30.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1HVH3 | 1-326 | MATMGTLSPRREATEARRTAASQIKPGGVDPLGLRAINFDLMDRVFPGVNNVARHIRPFVVVTWAWRRAAQLAARSGMHQVAAEILQ… |
| A0A1I7MCI2 | 1-331 | MVDTLNIPEWTHYADKGGLDPLGMQNSSVALYQRLIPGIGNVTLRMRYYGLYPWLVRHYLQANGSTDPETWRVFLRRAEALYALIAN… |
| A0A1E4K8A7 | 13-326 | None |
| A0A7J3D7L9 | 1-284 | None |
| A0A520YWG2 | 1-249 | None |
| A0A318HRD2 | 16-315 | None |
| A0A367PSC0 | 1-252 | None |
| A0A432DVM2 | 1-310 | None |
| A0A2G6SFX8 | 37-371 | None |
| A0A1Q8JXT3 | 1-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.