DPCstruct | MC31058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1E989 | 7-141 | LTTNFARLVLLAGHGANVVNNPHASGLHCGACGGYPGDVNARLLAALLNDAEVRRGLVLEGIKIPDDALFVGALHDTTTDAVTLYAE… |
| A0A2R7S7T0 | 343-471 | LRAMSLTANFARLVLLAGHGANVVNNPHASGLHCGACGGFSGEVNARLVAALLNDPQVRAGLVPEGIEIPADTLFLAALHDTTTDAI… |
| A0A7C3QX10 | 184-315 | None |
| A0A519UGZ0 | 360-471 | None |
| A0A2N5XYN0 | 223-318 | None |
| A0A7W1HG86 | 4-122 | None |
| A0A2G4ITM2 | 85-218 | None |
| A0A7Y8LE63 | 134-240 | None |
| A0A0M2USR7 | 535-663 | None |
| A0A2T2X529 | 713-818 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.