DPCstruct | MC31051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 314 ± 24 aa |
| Standard deviation of domain lengths | 24.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4MYI8 | 3-267 | LEIFLIVAEEAELPALSALMRTNSQIYAGIVEYEQSICKTRMQRYMLAPSCDVVSTRTPEREVYPRFSLDTMGELERRQKRIASIVS… |
| M7TP03 | 7-350 | LPMELVLDLAEHMDIASLKQFMATNKDLYELINSHEWSITEAKTSAYTLPPCGKYIMSSTTITRHVLSCGTFKAAAELERRERRVDD… |
| A0A2S7NWF3 | 42-355 | None |
| A0A0G4MMI7 | 15-289 | None |
| A0A1Y2DM16 | 2-311 | None |
| A0A2S7PA37 | 10-295 | None |
| A0A1Y1ZUN2 | 8-317 | None |
| A0A5J5EWT1 | 1-295 | None |
| A0A6A6BSV6 | 13-344 | None |
| A0A6G1H643 | 77-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.