DPCstruct | MC3105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0A1N2 | 70-163 | QPTVDAVTCKLAGIEDLPVIPREVEDILSIKQAERHRWLKDGRLQSAGTRTVKLRGRARKITFHVFDPRHIEDVLDRDLPEVWREED… |
| A0A7Y6W6M7 | 1-104 | MADMNAVSDFISRIDEKLDRLRNEKITIKMLEEILLLTPLERQRWTKDGRLPAAGNSYIDRGQKIRLWTYSPDVVARLWKNPEIIEN… |
| F3S3X6 | 63-158 | None |
| A0A1B3MGY7 | 231-330 | None |
| A0A850PD71 | 65-150 | None |
| A0A839X6W9 | 1-97 | None |
| A0A0R3E4J5 | 73-161 | None |
| A0A2K1DYW6 | 9-99 | None |
| A0A5C7UGV6 | 98-191 | None |
| A0A7W9ZIW4 | 78-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.