DPCstruct | MC31049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7CG02 | 32-133 | AFTRAYINFKNSSEIFNFRDKFDGYVFVDQKGNEFPAMVEFAPFQKVPKRIGSKKKDARCGTIDQDPDYLEFLETIANPETVTLQPL… |
| V4TN11 | 1-88 | MKKPADVFEFAELLNGHLFVNEKVAQFKAVVGYVPSQRVPKPCSRKDSREGTIFKDPDYLEFLKVIAKPAENLPSSEIQLERKEAELS |
| A0A498NAN5 | 96-185 | None |
| K7FE35 | 2-100 | None |
| A0A820KQD2 | 21-131 | None |
| A0A200Q2U9 | 5-103 | None |
| A0A3Q0H5N1 | 2-100 | None |
| A0A5C7HB16 | 101-189 | None |
| A0A2H5QTV3 | 23-122 | None |
| A0A5N6M0H9 | 17-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.