DPCstruct | MC31047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0JKF0 | 123-205 | SGDRFRVIGVWHTISRAYASPMFRLKVRNADRFDFKTSTGEATGEVSLKLKGLASELLGLELDLEMIYDMLIDTVKLLWELFL |
| V4T8F6 | 1-101 | MYVYGPWGSHILGKDTELLGFWHTEFKSYKSPSLKLKVRNADRFDFKTATGEATIEINLKLRRIVSEIQDGKIDTDSVYSGFKDNLR… |
| A0A0A0LHA6 | 38-112 | None |
| A0A498IK89 | 656-751 | None |
| A0A4S4DMR0 | 276-355 | None |
| A0A5N5HT74 | 1-101 | None |
| A0A7N0RAV7 | 70-156 | None |
| A0A6A2WQG9 | 33-117 | None |
| A0A2H5N004 | 47-130 | None |
| A0A059D3N5 | 545-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.