DPCstruct | MC31045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537YJ43 | 70-143 | TATDAGALIEYFTKLAWVIEVVAKGPSKATVLSNEGLRFDLRVVPPESYGNLLQHFTGSKDHNVALRERAVKDG |
| A0A1V4ZQZ1 | 1-75 | MISPAPEQVMEAFCSLPAIGRVAKRGPTRSMVVLGSGLQVNLRVVEEGQYGAALLYFTGSKEHNIALRRRAIGLG |
| A0A0D6QLV5 | 196-285 | None |
| A0A0G0VHX9 | 178-258 | None |
| A0A1F8P1M2 | 107-196 | None |
| A0A535RU75 | 310-400 | None |
| T0YEC5 | 200-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.