DPCstruct | MC31041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 289 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N0GZW5 | 3-246 | IRDEWGVTEGKVREAAAAVGTESPIVFVLLPKIEAEAIADTLASYAAATDTVSQRPEPQTEEGRQAKQGMQSRVLEGQQRLENLFAT… |
| A0A6J4Y3D5 | 1-285 | MRRLYIKNCLQNELKEADCPEQIPFIIVIMHDDDGKLKRALAEYWILNNDLTDEEESKYSNFIKDYMSQLDDEFRTIAEKMIQDRLY… |
| A0A838UIX6 | 6-283 | None |
| A0A482Z4S3 | 164-449 | None |
| A0A6L7SU47 | 129-409 | None |
| A0A1P8FA57 | 8-303 | None |
| A0A6L7WMJ5 | 48-374 | None |
| A0A843DG66 | 490-775 | None |
| A0A397S6S4 | 628-929 | None |
| A0A0F3GY39 | 258-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.