DPCstruct | MC31037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 2 aa |
| Standard deviation of domain lengths | 2.47 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 84.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8LHU2 | 95-169 | MPMLVRYLDGAEEPKDGVFLLEAVETETRRCVWKLADVRENRDPRSKGRPMSRRQRDWRLEVPFEMLNRVMLYVP |
| A0A2P2PVS6 | 1-79 | MPMRVLYLEGSGSSCLEQTGVFFLESIEMEAKNCVWKLADVKENRDPESKGRPLSRKKRDWRLPLSFETHRRVTLYLEF |
| A0A2K3LWE7 | 90-165 | None |
| A0A4D6LNI3 | 190-267 | None |
| K7K259 | 79-156 | None |
| A0A804NQC4 | 91-169 | None |
| A0A6I9SKQ2 | 360-439 | None |
| A0A7J7NW38 | 285-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.